PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33154.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 428aa    MW: 47874.6 Da    PI: 8.9485
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33154.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.27.8e-101311681954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  KHN33154.1 131 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 168
                 664459******************************88 PP

2BELL1086e-35166772
        BELL  7 kkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                +kkakL+ +l+eV++rY+qy++q+++v ssFe++ag+gsa+ Yt+lAl++iS++FrcLkdaia+q+
  KHN33154.1  1 MKKAKLIGMLDEVEQRYRQYHQQMEIVGSSFEQAAGIGSARTYTALALQTISKQFRCLKDAIAGQV 66
                69*************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.4E-10164IPR006563POX domain
PfamPF075266.9E-30163IPR006563POX domain
PROSITE profilePS5007112.195109172IPR001356Homeobox domain
CDDcd000861.34E-11112173No hitNo description
SMARTSM003895.3E-9112176IPR001356Homeobox domain
SuperFamilySSF466893.12E-17113179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-29115178IPR009057Homeodomain-like
PfamPF059201.6E-18129168IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MKKAKLIGML DEVEQRYRQY HQQMEIVGSS FEQAAGIGSA RTYTALALQT ISKQFRCLKD  60
AIAGQVRTAN KSLGEEDCFG GKMEGSRLKY VDHHLRQQRA LQQLGMIQHN AWRPQRGLPE  120
RSVSVLRAWL FEHFLHPYPK DSDKHMLAKQ TGLTRSQVSN WFINARVRLW KPMVEEMYTE  180
EMKDHEQNRS EDKSSKSNED SASKMSAPQD KGPSNETEAK SFNSKHEVSK SQNTAMVSVS  240
RPSTSPLGVN VRSQSGFSFM GSSELDGITQ GSPKKPRNHE MMHSPNSVPS MSMDVKPNDE  300
NNEQLSMKFG VERQGRNESS FMGNQTNFNG GFGQYPIGDI GRFDTEQFTP RLSGNGVSLT  360
LGLDSLPGTH QTFLPNQNIQ LGRSLDIGEP NEFGAISTSS PHSTAAYESI SMQNPKRFAA  420
QLLPDFVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16118176563Homeobox protein Meis2
3k2a_B2e-16118176563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003521496.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_006577097.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_006577098.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-132BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0B2RLF00.0A0A0B2RLF0_GLYSO; BEL1-like homeodomain protein 1
STRINGGLYMA03G36070.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16273492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-114BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]